Products

Enzymes for Research, Diagnostic and Industrial Use

α-Bungarotoxin

Cat No.
CEI-1182
Description
α-Bungarotoxin is a snake venom-derived toxin that irreversibly binds nicotinic acetylcholine receptors (Ki = ~ 2.5 µM in rat) present in skeletal muscle, blocking action of acetylcholine at the postsynaptic membrane and leading to paralysis. It has been widely used to characterize activity at the neuromuscular junction, which has numerous applications in neuroscience research.
Abbr
α-BTX
Appearance
A white to off-white solid
CAS_No
11032-79-4
Molecular Weight
7984.3
Purity
>99%
Stability
1 years
Storage
-20 centigrade
Synonyms
α-BTX, α-Bgt
Targets
α7, α1/β1/γ/δ nAChR, GABA(A) receptor subtypes
Molecular Formula
C338H529N97O105S11
Solubility
Soluble in aqueous buffers
Shipping Conditions
Room temperature in continental US; may vary elsewhere
Amino Acid Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

For research and industrial use only, not for personal medicinal use.

Products
Online Inquiry

For research and industrial use only, not for personal medicinal use.

0
Click unfold / close
Inquiry Basket
Delete selected Quote Check Out
Decide to move out of the shopping cart?
Sure No, Back

Please choose product!

< Go Back
You have already added to buy this product