Products

Enzymes for Research, Diagnostic and Industrial Use

α-Bungarotoxin

Cat No.
CEI-1182
Description
α-Bungarotoxin is a snake venom-derived toxin that irreversibly binds nicotinic acetylcholine receptors (Ki = ~ 2.5 µM in rat) present in skeletal muscle, blocking action of acetylcholine at the postsynaptic membrane and leading to paralysis. It has been widely used to characterize activity at the neuromuscular junction, which has numerous applications in neuroscience research.
Abbr
α-BTX
Appearance
A white to off-white solid
CAS No.
11032-79-4
Molecular Weight
7984.3
Purity
>99%
Stability
1 years
Storage
-20 centigrade
Synonyms
α-BTX, α-Bgt
Targets
α7, α1/β1/γ/δ nAChR, GABA(A) receptor subtypes
Molecular Formula
C338H529N97O105S11
Solubility
Soluble in aqueous buffers
Shipping Conditions
Room temperature in continental US; may vary elsewhere
Amino Acid Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Download Datasheet:



Inquiry
Realted Products
Catalog
ProductName
EC No.
CAS No.
Source
Price
CatalogCEI-1180
ProductNameWaglerin-1
EC No.
CAS No.
SourceSynthetic peptide
CatalogCEI-1181
EC No.
CAS No.
SourceSynthetic peptide
CatalogCEI-1183
EC No.
CAS No.21019-30-7
Source
Online Inquiry
Name:
*Phone:
*E-mail Address:
Country:
Company/Institution:
*Products or Services Interested:
Quantity:
Project Description:
Our Products are Not Intended for Private Therapeutic Use!
*Verification Code:
Please input "enzymes"(case insensitive) as verification code.

Welcome! For price inquiries, please feel free to contact us through the form below through the form on the left side. We will get back to you as soon as possible.

Sitemap  Privacy Policy
Copyright ©2011 - 2017 Creative Enzymes.
Contact Us 45-1 Ramsey Road, Shirley, NY 11967, USA
Email: info@creative-enzymes.com
Tel: 1-631-562-8517 1-631-448-7888
Fax: 1-631-938-8127
Distributors To view the contact information for a specific location, select the desired country: